SCOPe 2.07: Domain d6lsnb1: 6lsn B:2-245

Lineage for d6lsnb1 (6lsn B:2-245)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [224884] (26 PDB entries)

8. Domain d6lsnb1: 6lsn B:2-245 [399794]
   Other proteins in same PDB: d6lsna2, d6lsnb2, d6lsnc2, d6lsnd2, d6lsne_, d6lsnf1, d6lsnf2, d6lsnf3
   automated match to d4drxb1
   complexed with acp, ca, cl, err, gdp, gtp, mes, mg

Details for d6lsnb1

PDB Entry: 6lsn, 2.45 Å

PDB Description: crystal structure of tubulin-inhibitor complex

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d6lsnb1:

Sequence; same for both SEQRES and ATOM records:

>d6lsnb1 c.32.1.1 (B:2-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d6lsnb1:

• d6lsnb1 is new in SCOPe 2.07-stable
  
• d6lsnb1 appears in the current release, SCOPe 2.08