| Class b: All beta proteins [48724] (178 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
| Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
| Protein automated matches [254496] (16 species) not a true protein |
| Species Hydrogenobacter thermophilus [TaxId:940] [399169] (3 PDB entries) |
| Domain d7kblb3: 7kbl B:329-451 [399216] Other proteins in same PDB: d7kbla1, d7kbla2, d7kbla4, d7kblb1, d7kblb2 automated match to d1ulza1 complexed with bct |
PDB Entry: 7kbl (more details), 2.3 Å
SCOPe Domain Sequences for d7kblb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kblb3 b.84.2.0 (B:329-451) automated matches {Hydrogenobacter thermophilus [TaxId: 940]}
fngysiecrinaedpkkgfapsigtieryyvpggfgirvehasskgyeitpyydsliakl
ivwaplwevavdrmrsaletyeisgvkttipllinimkdkdfrdgkfttryleehphvfd
yae
Timeline for d7kblb3:
View in 3DDomains from other chains: (mouse over for more information) d7kbla1, d7kbla2, d7kbla3, d7kbla4 |