Lineage for d7kblb3 (7kbl B:329-451)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817540Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2817665Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2817666Protein automated matches [254496] (16 species)
    not a true protein
  7. 2817709Species Hydrogenobacter thermophilus [TaxId:940] [399169] (3 PDB entries)
  8. 2817715Domain d7kblb3: 7kbl B:329-451 [399216]
    Other proteins in same PDB: d7kbla1, d7kbla2, d7kbla4, d7kblb1, d7kblb2
    automated match to d1ulza1
    complexed with bct

Details for d7kblb3

PDB Entry: 7kbl (more details), 2.3 Å

PDB Description: biotin carboxylase domain of thermophilic 2-oxoglutarate carboxylase bound to bicarbonate
PDB Compounds: (B:) 2-oxoglutarate carboxylase small subunit

SCOPe Domain Sequences for d7kblb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kblb3 b.84.2.0 (B:329-451) automated matches {Hydrogenobacter thermophilus [TaxId: 940]}
fngysiecrinaedpkkgfapsigtieryyvpggfgirvehasskgyeitpyydsliakl
ivwaplwevavdrmrsaletyeisgvkttipllinimkdkdfrdgkfttryleehphvfd
yae

SCOPe Domain Coordinates for d7kblb3:

Click to download the PDB-style file with coordinates for d7kblb3.
(The format of our PDB-style files is described here.)

Timeline for d7kblb3: