| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
| Protein automated matches [226903] (39 species) not a true protein |
| Species Hydrogenobacter thermophilus [TaxId:940] [399165] (3 PDB entries) |
| Domain d7kbla1: 7kbl A:1-114 [399172] Other proteins in same PDB: d7kbla2, d7kbla3, d7kbla4, d7kblb2, d7kblb3 automated match to d1ulza2 complexed with bct |
PDB Entry: 7kbl (more details), 2.3 Å
SCOPe Domain Sequences for d7kbla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kbla1 c.30.1.0 (A:1-114) automated matches {Hydrogenobacter thermophilus [TaxId: 940]}
mfkkvlvanrgeiacrvirackelgiqtvaiyneiestarhvkmadeaymigvnpldtyl
naerivdlalevgaeaihpgygflaenehfarlceekgitfigphwkvielmgd
Timeline for d7kbla1: