Lineage for d7kbla1 (7kbl A:1-114)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470597Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2470598Protein automated matches [226903] (39 species)
    not a true protein
  7. 2470696Species Hydrogenobacter thermophilus [TaxId:940] [399165] (3 PDB entries)
  8. 2470701Domain d7kbla1: 7kbl A:1-114 [399172]
    Other proteins in same PDB: d7kbla2, d7kbla3, d7kbla4, d7kblb2, d7kblb3
    automated match to d1ulza2
    complexed with bct

Details for d7kbla1

PDB Entry: 7kbl (more details), 2.3 Å

PDB Description: biotin carboxylase domain of thermophilic 2-oxoglutarate carboxylase bound to bicarbonate
PDB Compounds: (A:) 2-oxoglutarate carboxylase small subunit

SCOPe Domain Sequences for d7kbla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kbla1 c.30.1.0 (A:1-114) automated matches {Hydrogenobacter thermophilus [TaxId: 940]}
mfkkvlvanrgeiacrvirackelgiqtvaiyneiestarhvkmadeaymigvnpldtyl
naerivdlalevgaeaihpgygflaenehfarlceekgitfigphwkvielmgd

SCOPe Domain Coordinates for d7kbla1:

Click to download the PDB-style file with coordinates for d7kbla1.
(The format of our PDB-style files is described here.)

Timeline for d7kbla1: