SCOPe 2.08: Domain d1ffke_: 1ffk E:

Lineage for d1ffke_ (1ffk E:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (4 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Ribosomal protein L7ae [55319] (7 species)

7. Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
   Uniprot P12743

8. Domain d1ffke_: 1ffk E: [39812]
   Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_
   complexed with cd, k, mg

Details for d1ffke_

PDB Entry: 1ffk, 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

PDB Compounds: (E:) ribosomal protein l7ae

SCOPe Domain Sequences for d1ffke_:

Sequence; same for both SEQRES and ATOM records:

>d1ffke_ d.79.3.1 (E:) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
vyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeivm
hipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

Timeline for d1ffke_:

• d1ffke_ first appeared (with stable ids) in SCOP 1.55
  
• d1ffke_ appears in SCOPe 2.07