SCOPe 2.08: Domain d1ffka1: 1ffk A:91-237

Lineage for d1ffka1 (1ffk A:91-237)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries)
   Uniprot P20276

8. Domain d1ffka1: 1ffk A:91-237 [24612]
   Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_
   CA-atoms only; includes the C-terminal tail
   complexed with cd, k, mg

Details for d1ffka1

PDB Entry: 1ffk, 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

PDB Compounds: (A:) ribosomal protein l2

SCOPe Domain Sequences for d1ffka1:

Sequence; same for both SEQRES and ATOM records:

>d1ffka1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

Timeline for d1ffka1:

• d1ffka1 first appeared (with stable ids) in SCOP 1.55
  
• d1ffka1 appears in SCOPe 2.07