SCOPe 2.08: Domain d1ffky_: 1ffk Y:

Lineage for d1ffky_ (1ffk Y:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family)
   interrupted alpha-helix
   automatically mapped to Pfam PF00832

5. Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)

6. Protein Ribosomal protein L39e [48664] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
   Uniprot P22452

8. Domain d1ffky_: 1ffk Y: [19624]
   Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_
   complexed with cd, k, mg

Details for d1ffky_

PDB Entry: 1ffk, 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

PDB Compounds: (Y:) ribosomal protein l39e

SCOPe Domain Sequences for d1ffky_:

Sequence, based on SEQRES records:

>d1ffky_ a.137.1.1 (Y:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrkakldnqnsrvpayvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records):

>d1ffky_ a.137.1.1 (Y:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrkakldnqnsrvpayvmlktde

Timeline for d1ffky_:

• d1ffky_ first appeared (with stable ids) in SCOP 1.55
  
• d1ffky_ appears in SCOPe 2.07