SCOPe 2.08: Domain d1ffki_: 1ffk I:

Lineage for d1ffki_ (1ffk I:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.2: L15e [54193] (1 protein)
   elaborated with additional structures
   automatically mapped to Pfam PF00827

6. Protein Ribosomal protein L15e [54194] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [54195] (42 PDB entries)
   Uniprot P60618

8. Domain d1ffki_: 1ffk I: [37494]
   Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_
   complexed with cd, k, mg

Details for d1ffki_

PDB Entry: 1ffk, 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

PDB Compounds: (I:) ribosomal protein l15e

SCOPe Domain Sequences for d1ffki_:

Sequence; same for both SEQRES and ATOM records:

>d1ffki_ d.12.1.2 (I:) Ribosomal protein L15e {Haloarcula marismortui [TaxId: 2238]}
mksmyayireawkrpyegyvgelmwhrlqkwrrepavvriprptrldraralgykakkgi
ivvrvrirrggrratrpnkgrkskkmmvnrrprkknlqwiaeeranrkypnmevlnsywv
gedgrykwfevilvdrdhpaiksdpqlswvsrtrgrvyrgltsagrkarglrrkgrgaek
vrpslranfrkkrr

Timeline for d1ffki_:

• d1ffki_ first appeared (with stable ids) in SCOP 1.55
  
• d1ffki_ appears in SCOPe 2.07