Lineage for d1fsz_2 (1fsz 232-356)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134814Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
  4. 134879Superfamily d.79.2: Tubulin, C-terminal domain [55307] (1 family) (S)
  5. 134880Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 134881Protein Cell-division protein FtsZ [55309] (1 species)
  7. 134882Species Archaeon Methanococcus jannaschii [TaxId:2190] [55310] (1 PDB entry)
  8. 134883Domain d1fsz_2: 1fsz 232-356 [39802]
    Other proteins in same PDB: d1fsz_1

Details for d1fsz_2

PDB Entry: 1fsz (more details), 2.8 Å

PDB Description: crystal structure of the cell-division protein ftsz at 2.8a resolution

SCOP Domain Sequences for d1fsz_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsz_2 d.79.2.1 (232-356) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl
krkkl

SCOP Domain Coordinates for d1fsz_2:

Click to download the PDB-style file with coordinates for d1fsz_2.
(The format of our PDB-style files is described here.)

Timeline for d1fsz_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fsz_1