Lineage for d1fsz_2 (1fsz 232-356)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (4 superfamilies) 
Superfamily d.79.2: Tubulin, C-terminal domain [55307] (1 family) 
Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins) Protein Cell-division protein FtsZ [55309] (1 species) Species Methanococcus jannaschii [TaxId:2190] [55310] (1 PDB entry) 
Domain d1fsz_2: 1fsz 232-356 [39802]
Other proteins in same PDB: d1fsz_1
Details for d1fsz_2
PDB Entry: 1fsz (more details), 2.8 Å
PDB Description: crystal structure of the cell-division protein ftsz at 2.8a resolution
SCOP Domain Sequences for d1fsz_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fsz_2 d.79.2.1 (232-356) Cell-division protein FtsZ {Methanococcus jannaschii}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl
krkkl
SCOP Domain Coordinates for d1fsz_2:
Click to download the PDB-style file with coordinates for d1fsz_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fsz_2:
- d1fsz_2 appears in SCOP 1.57
- d1fsz_2 appears in the current release, SCOPe 2.08, called d1fsza2
View in 3D
