SCOP 1.57: Domain d1fsz_2: 1fsz 232-356

Lineage for d1fsz_2 (1fsz 232-356)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (4 superfamilies)

4. Superfamily d.79.2: Tubulin, C-terminal domain [55307] (1 family)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)

6. Protein Cell-division protein FtsZ [55309] (1 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [55310] (1 PDB entry)

8. Domain d1fsz_2: 1fsz 232-356 [39802]
   Other proteins in same PDB: d1fsz_1

Details for d1fsz_2

PDB Entry: 1fsz, 2.8 Å

PDB Description: crystal structure of the cell-division protein ftsz at 2.8a resolution

SCOP Domain Sequences for d1fsz_2:

Sequence; same for both SEQRES and ATOM records:

>d1fsz_2 d.79.2.1 (232-356) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl
krkkl

Timeline for d1fsz_2:

• d1fsz_2 first appeared (with stable ids) in SCOP 1.55
  
• d1fsz_2 appears in SCOP 1.59
  
• d1fsz_2 appears in the current release, SCOPe 2.08, called d1fsza2