Lineage for d1fsza2 (1fsz A:232-356)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959093Protein Cell-division protein FtsZ [55309] (9 species)
  7. 2959105Species Methanococcus jannaschii [TaxId:2190] [55310] (7 PDB entries)
    Uniprot Q57816 23-360
  8. 2959111Domain d1fsza2: 1fsz A:232-356 [39802]
    Other proteins in same PDB: d1fsza1
    complexed with gdp
    missing some secondary structures that made up less than one-third of the common domain

Details for d1fsza2

PDB Entry: 1fsz (more details), 2.8 Å

PDB Description: crystal structure of the cell-division protein ftsz at 2.8a resolution
PDB Compounds: (A:) ftsz

SCOPe Domain Sequences for d1fsza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsza2 d.79.2.1 (A:232-356) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl
krkkl

SCOPe Domain Coordinates for d1fsza2:

Click to download the PDB-style file with coordinates for d1fsza2.
(The format of our PDB-style files is described here.)

Timeline for d1fsza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fsza1