Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (36 species) not a true protein |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [397752] (1 PDB entry) |
Domain d6vanb_: 6van B: [397768] automated match to d1ahra_ complexed with edo, sr, unx |
PDB Entry: 6van (more details), 1.33 Å
SCOPe Domain Sequences for d6vanb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vanb_ a.39.1.0 (B:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} gvpfltelkerfirwldhdndgqstfdevknyirrfkpdvtdqtvaafisrrdsngngai dfvpeyvhdmaapdytleganewfklqdtnddsfvteaelvkvaeavgmspeealdtvqg yymsadankdgklsldefktlysp
Timeline for d6vanb_: