SCOPe 2.08: Domain d6vanb_: 6van B:

Lineage for d6vanb_ (6van B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [397752] (1 PDB entry)

8. Domain d6vanb_: 6van B: [397768]
   automated match to d1ahra_
   complexed with edo, sr, unx

Details for d6vanb_

PDB Entry: 6van, 1.33 Å

PDB Description: crystal structure of caltubin from the great pond snail

PDB Compounds: (B:) Caltubin, EF-hand

SCOPe Domain Sequences for d6vanb_:

Sequence; same for both SEQRES and ATOM records:

>d6vanb_ a.39.1.0 (B:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
gvpfltelkerfirwldhdndgqstfdevknyirrfkpdvtdqtvaafisrrdsngngai
dfvpeyvhdmaapdytleganewfklqdtnddsfvteaelvkvaeavgmspeealdtvqg
yymsadankdgklsldefktlysp

Timeline for d6vanb_:

• d6vanb_ first appeared in SCOPe 2.07