PDB entry 6van

View 6van on RCSB PDB site
Description: Crystal structure of caltubin from the great pond snail
Class: metal binding protein
Keywords: EF-hand, calcium-binding protein, invertebrate, Structural Genomics Consortium, SGC, METAL BINDING PROTEIN
Deposited on 2019-12-17, released 2020-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-12-23, with a file datestamp of 2020-12-18.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caltubin, EF-hand
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 6VAN (0-89)
    • Uniprot Q2VA57 (90-143)
    Domains in SCOPe 2.08: d6vana_
  • Chain 'B':
    Compound: Caltubin, EF-hand
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 6VAN (0-89)
    • Uniprot Q2VA57 (90-143)
    Domains in SCOPe 2.08: d6vanb_
  • Heterogens: SR, EDO, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6vanA (A:)
gvpfltelkerfirwldhdndgqstfdevknyirrfkpdvtdqtvaafisrrdsngngai
dfvpeyvhdmaapdytleganewfklqdtnddsfvteaelvkvaeavgmspeealdtvqg
yymsadankdgklsldefktlysp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6vanB (B:)
gvpfltelkerfirwldhdndgqstfdevknyirrfkpdvtdqtvaafisrrdsngngai
dfvpeyvhdmaapdytleganewfklqdtnddsfvteaelvkvaeavgmspeealdtvqg
yymsadankdgklsldefktlysp