SCOP 1.55: Domain d2chsh_: 2chs H:

Lineage for d2chsh_ (2chs H:)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (4 superfamilies)

4. Superfamily d.79.1: YjgF-like [55298] (2 families)

5. Family d.79.1.2: Chorismate mutase [55304] (1 protein)

6. Protein Chorismate mutase [55305] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [55306] (6 PDB entries)

8. Domain d2chsh_: 2chs H: [39771]

Details for d2chsh_

PDB Entry: 2chs, 1.9 Å

PDB Description: crystal structures of the monofunctional chorismate mutase from bacillus subtilis and its complex with a transition state analog

SCOP Domain Sequences for d2chsh_:

Sequence; same for both SEQRES and ATOM records:

>d2chsh_ d.79.1.2 (H:) Chorismate mutase {Bacillus subtilis}
mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvl

Timeline for d2chsh_:

• d2chsh_ appears in SCOP 1.57
  
• d2chsh_ appears in the current release, SCOPe 2.08