Lineage for d2chsb_ (2chs B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (4 superfamilies) Superfamily d.79.1: YjgF-like [55298] (2 families) 
Family d.79.1.2: Chorismate mutase [55304] (1 protein) Protein Chorismate mutase [55305] (1 species) Species Bacillus subtilis [TaxId:1423] [55306] (6 PDB entries) 
Domain d2chsb_: 2chs B: [39765]
Details for d2chsb_
PDB Entry: 2chs (more details), 1.9 Å
PDB Description: crystal structures of the monofunctional chorismate mutase from bacillus subtilis and its complex with a transition state analog
SCOP Domain Sequences for d2chsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2chsb_ d.79.1.2 (B:) Chorismate mutase {Bacillus subtilis}
mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvl
SCOP Domain Coordinates for d2chsb_:
Click to download the PDB-style file with coordinates for d2chsb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2chsb_:
- d2chsb_ appears in SCOP 1.57
- d2chsb_ appears in the current release, SCOPe 2.08
View in 3D
