SCOPe 2.08: Domain d6zb6d1: 6zb6 D:1-84

Lineage for d6zb6d1 (6zb6 D:1-84)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein automated matches [227019] (4 species)
   not a true protein

7. Species Lolium rigidum [TaxId:89674] [396703] (1 PDB entry)

8. Domain d6zb6d1: 6zb6 D:1-84 [396704]
   Other proteins in same PDB: d6zb6a2, d6zb6a3, d6zb6b2, d6zb6c2, d6zb6c3, d6zb6d2, d6zb6e2, d6zb6f2
   automated match to d1axda2
   complexed with gol, gsh, gtb, na

Details for d6zb6d1

PDB Entry: 6zb6, 1.9 Å

PDB Description: crystal structure of lolium rigidum gstf in complex with s-(p- nitrobenzyl) glutathione

PDB Compounds: (D:) glutathione transferase

SCOPe Domain Sequences for d6zb6d1:

Sequence; same for both SEQRES and ATOM records:

>d6zb6d1 c.47.1.5 (D:1-84) automated matches {Lolium rigidum [TaxId: 89674]}
mapvkvfgpamstnvarvlvfleevgadyevvdmdfkvmehkspehlarnpfgqipafqd
gdlllfesraiskyvlrkyktgev

Timeline for d6zb6d1:

• d6zb6d1 first appeared in SCOPe 2.07