![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein automated matches [226848] (14 species) not a true protein |
![]() | Species Lolium rigidum [TaxId:89674] [396705] (1 PDB entry) |
![]() | Domain d6zb6b2: 6zb6 B:85-215 [396720] Other proteins in same PDB: d6zb6a1, d6zb6a3, d6zb6b1, d6zb6c1, d6zb6c3, d6zb6d1, d6zb6e1, d6zb6f1 automated match to d1axda1 complexed with gol, gsh, gtb, na |
PDB Entry: 6zb6 (more details), 1.9 Å
SCOPe Domain Sequences for d6zb6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zb6b2 a.45.1.1 (B:85-215) automated matches {Lolium rigidum [TaxId: 89674]} dllregnlkeaamvdvwtevdahtynpalspivyqclfnpmmrgiptdekvvaesleklk kvlevyearlsqheylagdfvsfadlnhfpytfyfmatphaalfgsyphvkawwerimar paikkisatmv
Timeline for d6zb6b2: