Lineage for d6zb6c1 (6zb6 C:1-84)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2877295Protein automated matches [227019] (4 species)
    not a true protein
  7. 2877301Species Lolium rigidum [TaxId:89674] [396703] (1 PDB entry)
  8. 2877304Domain d6zb6c1: 6zb6 C:1-84 [396712]
    Other proteins in same PDB: d6zb6a2, d6zb6a3, d6zb6b2, d6zb6c2, d6zb6c3, d6zb6d2, d6zb6e2, d6zb6f2
    automated match to d1axda2
    complexed with gol, gsh, gtb, na

Details for d6zb6c1

PDB Entry: 6zb6 (more details), 1.9 Å

PDB Description: crystal structure of lolium rigidum gstf in complex with s-(p- nitrobenzyl) glutathione
PDB Compounds: (C:) glutathione transferase

SCOPe Domain Sequences for d6zb6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zb6c1 c.47.1.5 (C:1-84) automated matches {Lolium rigidum [TaxId: 89674]}
mapvkvfgpamstnvarvlvfleevgadyevvdmdfkvmehkspehlarnpfgqipafqd
gdlllfesraiskyvlrkyktgev

SCOPe Domain Coordinates for d6zb6c1:

Click to download the PDB-style file with coordinates for d6zb6c1.
(The format of our PDB-style files is described here.)

Timeline for d6zb6c1: