SCOPe 2.08: Domain d6zb6a2: 6zb6 A:85-219

Lineage for d6zb6a2 (6zb6 A:85-219)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (14 species)
   not a true protein

7. Species Lolium rigidum [TaxId:89674] [396705] (1 PDB entry)

8. Domain d6zb6a2: 6zb6 A:85-219 [396708]
   Other proteins in same PDB: d6zb6a1, d6zb6a3, d6zb6b1, d6zb6c1, d6zb6c3, d6zb6d1, d6zb6e1, d6zb6f1
   automated match to d1axda1
   complexed with gol, gsh, gtb, na

Details for d6zb6a2

PDB Entry: 6zb6, 1.9 Å

PDB Description: crystal structure of lolium rigidum gstf in complex with s-(p- nitrobenzyl) glutathione

PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d6zb6a2:

Sequence; same for both SEQRES and ATOM records:

>d6zb6a2 a.45.1.1 (A:85-219) automated matches {Lolium rigidum [TaxId: 89674]}
dllregnlkeaamvdvwtevdahtynpalspivyqclfnpmmrgiptdekvvaesleklk
kvlevyearlsqheylagdfvsfadlnhfpytfyfmatphaalfgsyphvkawwerimar
paikkisatmvppka

Timeline for d6zb6a2:

• d6zb6a2 first appeared in SCOPe 2.07