Lineage for d1c05a_ (1c05 A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (3 families) 
Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein) Protein Ribosomal protein S4 [55179] (2 species) Species Bacillus stearothermophilus [TaxId:1422] [55181] (2 PDB entries) 
Domain d1c05a_: 1c05 A: [39559]
Details for d1c05a_
PDB Entry: 1c05 (more details)
PDB Description: solution structure of ribosomal protein s4 delta 41, refined with dipolar couplings (minimized average structure)
SCOP Domain Sequences for d1c05a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c05a_ d.66.1.2 (A:) Ribosomal protein S4 {Bacillus stearothermophilus}
mklseyglqlqekqklrhmygvnerqfrktfeeagkmpgkhgenfmillesrldnlvyrl
glartrrqarqlvthghilvdgsrvnipsyrvkpgqtiavreksrnlqvikealeannyi
pdylsfdpekmegtytrlperselpaeinealivefysr
SCOP Domain Coordinates for d1c05a_:
Click to download the PDB-style file with coordinates for d1c05a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c05a_:
- d1c05a_ appears in SCOP 1.57
- d1c05a_ appears in the current release, SCOPe 2.08
View in 3D