![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) |
![]() | Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (3 families) ![]() |
![]() | Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein) |
![]() | Protein Ribosomal protein S4 [55179] (2 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [55181] (2 PDB entries) |
![]() | Domain d1c05a_: 1c05 A: [39559] |
PDB Entry: 1c05 (more details)
SCOP Domain Sequences for d1c05a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c05a_ d.66.1.2 (A:) Ribosomal protein S4 {Bacillus stearothermophilus} mklseyglqlqekqklrhmygvnerqfrktfeeagkmpgkhgenfmillesrldnlvyrl glartrrqarqlvthghilvdgsrvnipsyrvkpgqtiavreksrnlqvikealeannyi pdylsfdpekmegtytrlperselpaeinealivefysr
Timeline for d1c05a_: