![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
![]() | Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) ![]() common motif in otherwise different folds |
![]() | Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
![]() | Protein Ribosomal protein S4 [55179] (3 species) also contains a Zn-binding N-terminal subdomain |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [55181] (2 PDB entries) |
![]() | Domain d1c05a_: 1c05 A: [39559] |
PDB Entry: 1c05 (more details)
SCOPe Domain Sequences for d1c05a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c05a_ d.66.1.2 (A:) Ribosomal protein S4 {Bacillus stearothermophilus [TaxId: 1422]} mklseyglqlqekqklrhmygvnerqfrktfeeagkmpgkhgenfmillesrldnlvyrl glartrrqarqlvthghilvdgsrvnipsyrvkpgqtiavreksrnlqvikealeannyi pdylsfdpekmegtytrlperselpaeinealivefysr
Timeline for d1c05a_: