SCOP 1.55: Domain d1ftrc2: 1ftr C:149-296

Lineage for d1ftrc2 (1ftr C:149-296)

Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (1 family)
Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)
Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (1 species)
Species Methanopyrus kandleri [TaxId:2320] [55115] (1 PDB entry)
Domain d1ftrc2: 1ftr C:149-296 [39490]

Details for d1ftrc2

PDB Entry: 1ftr (more details), 1.7 Å

PDB Description: formylmethanofuran:tetrahydromethanopterin formyltransferase from methanopyrus kandleri

SCOP Domain Sequences for d1ftrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ftrc2 d.58.33.1 (C:149-296) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Methanopyrus kandleri}
egefivedsfgittgvaggnfyimaesqpaglqaaeaavdaikgvegayapfpggivasa
skvgskqydflpastndaycptvednelpegvkcvyeivinglneeavkeamrvgieaac
qqpgvvkisagnfggklgqyeihlhdlf

SCOP Domain Coordinates for d1ftrc2:

Click to download the PDB-style file with coordinates for d1ftrc2.
(The format of our PDB-style files is described here.)

Timeline for d1ftrc2: