Lineage for d1ftrc2 (1ftr C:149-296)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955351Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (2 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955352Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)
  6. 2955353Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)
  7. 2955371Species Methanopyrus kandleri [TaxId:2320] [55115] (3 PDB entries)
  8. 2955377Domain d1ftrc2: 1ftr C:149-296 [39490]

Details for d1ftrc2

PDB Entry: 1ftr (more details), 1.7 Å

PDB Description: formylmethanofuran:tetrahydromethanopterin formyltransferase from methanopyrus kandleri
PDB Compounds: (C:) formylmethanofuran:tetrahydromethanopterin formyltransferase

SCOPe Domain Sequences for d1ftrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ftrc2 d.58.33.1 (C:149-296) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Methanopyrus kandleri [TaxId: 2320]}
egefivedsfgittgvaggnfyimaesqpaglqaaeaavdaikgvegayapfpggivasa
skvgskqydflpastndaycptvednelpegvkcvyeivinglneeavkeamrvgieaac
qqpgvvkisagnfggklgqyeihlhdlf

SCOPe Domain Coordinates for d1ftrc2:

Click to download the PDB-style file with coordinates for d1ftrc2.
(The format of our PDB-style files is described here.)

Timeline for d1ftrc2: