Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (2 families) duplication: contains two subdomains of this fold |
Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein) |
Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species) |
Species Methanopyrus kandleri [TaxId:2320] [55115] (3 PDB entries) |
Domain d1ftrd2: 1ftr D:149-296 [39492] |
PDB Entry: 1ftr (more details), 1.7 Å
SCOPe Domain Sequences for d1ftrd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ftrd2 d.58.33.1 (D:149-296) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Methanopyrus kandleri [TaxId: 2320]} egefivedsfgittgvaggnfyimaesqpaglqaaeaavdaikgvegayapfpggivasa skvgskqydflpastndaycptvednelpegvkcvyeivinglneeavkeamrvgieaac qqpgvvkisagnfggklgqyeihlhdlf
Timeline for d1ftrd2: