Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
Protein automated matches [190304] (16 species) not a true protein |
Species Methylorubrum extorquens [TaxId:440085] [394396] (1 PDB entry) |
Domain d7c11c_: 7c11 C: [394400] Other proteins in same PDB: d7c11b2 automated match to d4iojb_ complexed with act, flc, tla |
PDB Entry: 7c11 (more details), 2.82 Å
SCOPe Domain Sequences for d7c11c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7c11c_ c.37.1.10 (C:) automated matches {Methylorubrum extorquens [TaxId: 440085]} psdieiaraatlkpiaqvaeklgipdealhnygkhiakidhdfiaslegkpegklvlvta isptpagegkttttvglgdalnrigkravmclrepslgpcfgmkggaagggkaqvvpmeq inlhftgdfhaitsahslaaalidnhiywanelnidvrrihwrrvvdmndralrainqsl ggvangfpredgfditvasevmavfclaknladleerlgriviaetrdrkpvtladvkat gamtvllkdalqpnlvqtlegnpalihggpfaniahgcnsviatrtglrladytvteagf gadlgaekfidikcrqtglkpssvvivatiralkmhggvnkkdlqaenldalekgfanle rhvnnvrsfglpvvvgvnhffqdtdaeharlkelcrdrlqveaitckhwaeggagaeala qavvklaegeqkpltfayetetkitdkikaiatklygaadiqieskaatklagfekdgyg klpvcmaktqysfstdptlmgapsghlvsvrdvrlsagagfvvvicgeimtmpglpkvpa adtirldangqidglf
Timeline for d7c11c_: