Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) |
Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein) |
Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [55038] (3 PDB entries) |
Domain d1dq9c1: 1dq9 C:587-703 [39374] Other proteins in same PDB: d1dq9a4, d1dq9b4, d1dq9c4, d1dq9d4 |
PDB Entry: 1dq9 (more details), 2.8 Å
SCOP Domain Sequences for d1dq9c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dq9c1 d.58.20.1 (C:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens)} gmtrgpvvrlpracdsaevkawletsegfavikeafdstsrfarlqklhtsiagrnlyir fqsrsgdamgmnmiskgtekalsklheyfpemqilavsgnyctdkkpaainwiegrg
Timeline for d1dq9c1: