Lineage for d1dq9b4 (1dq9 B:460-586,B:704-864)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37690Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
  4. 37691Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 37692Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 37693Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 37694Species Human (Homo sapiens) [TaxId:9606] [56545] (3 PDB entries)
  8. 37704Domain d1dq9b4: 1dq9 B:460-586,B:704-864 [42594]
    Other proteins in same PDB: d1dq9a1, d1dq9b1, d1dq9c1, d1dq9d1

Details for d1dq9b4

PDB Entry: 1dq9 (more details), 2.8 Å

PDB Description: complex of catalytic portion of human hmg-coa reductase with hmg-coa

SCOP Domain Sequences for d1dq9b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dq9b4 d.179.1.1 (B:460-586,B:704-864) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
kflsdaeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdyny
slvmgaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglggga
ssrvladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynahaan
ivtaiyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllpqq
aclqmlgvqgackdnpgenarqlarivcgtvmagelslmaalaaghlvk

SCOP Domain Coordinates for d1dq9b4:

Click to download the PDB-style file with coordinates for d1dq9b4.
(The format of our PDB-style files is described here.)

Timeline for d1dq9b4: