Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
Superfamily d.58.18: Regulatory domain in the aminoacid metabolism [55021] (3 families) |
Family d.58.18.2: Threonine deaminase C-terminal domain [55025] (1 protein) |
Protein Threonine deaminase C-terminal domain [55026] (1 species) |
Species Escherichia coli [TaxId:562] [55027] (1 PDB entry) |
Domain d1tdj_2: 1tdj 336-423 [39356] Other proteins in same PDB: d1tdj_1 |
PDB Entry: 1tdj (more details), 2.8 Å
SCOP Domain Sequences for d1tdj_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tdj_2 d.58.18.2 (336-423) Threonine deaminase C-terminal domain {Escherichia coli} qreallavtipeekgsflkfcqllggrsvtefnyrfadaknacifvgvrlsrgleerkei lqmlndggysvvdlsddemaklhvrymv
Timeline for d1tdj_2: