Lineage for d1tdj_2 (1tdj 336-423)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32939Superfamily d.58.18: Regulatory domain in the aminoacid metabolism [55021] (3 families) (S)
  5. 32945Family d.58.18.2: Threonine deaminase C-terminal domain [55025] (1 protein)
  6. 32946Protein Threonine deaminase C-terminal domain [55026] (1 species)
  7. 32947Species Escherichia coli [TaxId:562] [55027] (1 PDB entry)
  8. 32948Domain d1tdj_2: 1tdj 336-423 [39356]
    Other proteins in same PDB: d1tdj_1

Details for d1tdj_2

PDB Entry: 1tdj (more details), 2.8 Å

PDB Description: threonine deaminase (biosynthetic) from e. coli

SCOP Domain Sequences for d1tdj_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdj_2 d.58.18.2 (336-423) Threonine deaminase C-terminal domain {Escherichia coli}
qreallavtipeekgsflkfcqllggrsvtefnyrfadaknacifvgvrlsrgleerkei
lqmlndggysvvdlsddemaklhvrymv

SCOP Domain Coordinates for d1tdj_2:

Click to download the PDB-style file with coordinates for d1tdj_2.
(The format of our PDB-style files is described here.)

Timeline for d1tdj_2: