Lineage for d1tdj_1 (1tdj 5-335)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27517Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
  4. 27518Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 27519Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (4 proteins)
  6. 27536Protein Threonine deaminase N-terminal domain [53692] (1 species)
  7. 27537Species Escherichia coli [TaxId:562] [53693] (1 PDB entry)
  8. 27538Domain d1tdj_1: 1tdj 5-335 [35297]
    Other proteins in same PDB: d1tdj_2, d1tdj_3

Details for d1tdj_1

PDB Entry: 1tdj (more details), 2.8 Å

PDB Description: threonine deaminase (biosynthetic) from e. coli

SCOP Domain Sequences for d1tdj_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdj_1 c.79.1.1 (5-335) Threonine deaminase N-terminal domain {Escherichia coli}
qplsgapegaeylravlrapvyeaaqvtplqkmeklssrldnvilvkredrqpvhsfklr
gayammaglteeqkahgvitasagnhaqgvafssarlgvkalivmptatadikvdavrgf
ggevllhganfdeakakaielsqqqgftwvppfdhpmviagqgtlalellqqdahldrvf
vpvgggglaagvavlikqlmpqikviaveaedsaclkaaldaghpvdlprvglfaegvav
krigdetfrlcqeylddiitvdsdaicaamkdlfedvravaepsgalalagmkkyialhn
irgerlahilsganvnfhglryvsercelge

SCOP Domain Coordinates for d1tdj_1:

Click to download the PDB-style file with coordinates for d1tdj_1.
(The format of our PDB-style files is described here.)

Timeline for d1tdj_1: