Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [393072] (1 PDB entry) |
Domain d6wslf1: 6wsl F:1-243 [393079] Other proteins in same PDB: d6wsla2, d6wslb2, d6wsle2, d6wslf2 automated match to d5bmvb1 complexed with g2p, gtp |
PDB Entry: 6wsl (more details), 3.1 Å
SCOPe Domain Sequences for d6wslf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wslf1 c.32.1.1 (F:1-243) automated matches {Human (Homo sapiens) [TaxId: 9606]} mreivhiqagqcgnqigakfwevisdehgidpsgnyvgdsdlqlerisvyyneasshkyv prailvdlepgtmdsvrsgafghlfrpdnfifgqsgagnnwakghytegaelvdsvldvv rkecencdclqgfqlthslgggtgsgmgtlliskvreeypdrimntfsvvpspkvsdtvv epynatlsihqlventdetycidnealydicfrtlklatptygdlnhlvsatmsgvttsl rfp
Timeline for d6wslf1: