Lineage for d5bmvb1 (5bmv B:1-245)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) 
automatically mapped to Pfam PF00091Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) 
Protein Tubulin beta-subunit [52496] (2 species) Species Pig (Sus scrofa) [TaxId:9823] [52497] (9 PDB entries) 
Domain d5bmvb1: 5bmv B:1-245 [319660]
Other proteins in same PDB: d5bmva1, d5bmva2, d5bmvb2, d5bmvc1, d5bmvc2, d5bmvd2, d5bmve_, d5bmvf1, d5bmvf2, d5bmvf3
automated match to d1sa0b1
complexed with acp, ca, gdp, gol, gtp, mes, mg, vlb
Details for d5bmvb1
PDB Entry: 5bmv (more details), 2.5 Å
PDB Description: crystal structure of tubulin-stathmin-ttl-vinblastine complex
PDB Compounds: (B:) Tubulin beta chainSCOPe Domain Sequences for d5bmvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bmvb1 c.32.1.1 (B:1-245) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp
SCOPe Domain Coordinates for d5bmvb1:
Click to download the PDB-style file with coordinates for d5bmvb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5bmvb1:
- d5bmvb1 first appeared in SCOPe 2.06
- d5bmvb1 appears in SCOPe 2.07
View in 3D
