Lineage for d6wsla1 (6wsl A:1-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863308Protein automated matches [226837] (9 species)
    not a true protein
  7. 2863846Species Human (Homo sapiens) [TaxId:9606] [393072] (1 PDB entry)
  8. 2863847Domain d6wsla1: 6wsl A:1-245 [393077]
    Other proteins in same PDB: d6wsla2, d6wslb2, d6wsle2, d6wslf2
    automated match to d5kx5c1
    complexed with g2p, gtp

Details for d6wsla1

PDB Entry: 6wsl (more details), 3.1 Å

PDB Description: cryo-em structure of vash1-svbp bound to microtubules
PDB Compounds: (A:) tubulin alpha-1a chain

SCOPe Domain Sequences for d6wsla1:

Sequence, based on SEQRES records: (download)

>d6wsla1 c.32.1.1 (A:1-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
slrfd

Sequence, based on observed residues (ATOM records): (download)

>d6wsla1 c.32.1.1 (A:1-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpdsfntffsetgagkhvpravfvd
leptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladqc
tglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsil
tthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfd

SCOPe Domain Coordinates for d6wsla1:

Click to download the PDB-style file with coordinates for d6wsla1.
(The format of our PDB-style files is described here.)

Timeline for d6wsla1: