SCOPe 2.08: Domain d6wsla2: 6wsl A:246-440

Lineage for d6wsla2 (6wsl A:246-440)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [393074] (1 PDB entry)
Domain d6wsla2: 6wsl A:246-440 [393078]
Other proteins in same PDB: d6wsla1, d6wslb1, d6wsle1, d6wslf1
automated match to d4x1ic2
complexed with g2p, gtp

Details for d6wsla2

PDB Entry: 6wsl (more details), 3.1 Å

PDB Description: cryo-em structure of vash1-svbp bound to microtubules

PDB Compounds: (A:) tubulin alpha-1a chain

SCOPe Domain Sequences for d6wsla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wsla2 d.79.2.1 (A:246-440) automated matches {Human (Homo sapiens) [TaxId: 9606]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d6wsla2:

Click to download the PDB-style file with coordinates for d6wsla2.
(The format of our PDB-style files is described here.)

Timeline for d6wsla2: