SCOPe 2.07: Domain d6wslf1: 6wsl F:1-243

Lineage for d6wslf1 (6wsl F:1-243)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [393072] (1 PDB entry)

8. Domain d6wslf1: 6wsl F:1-243 [393079]
   Other proteins in same PDB: d6wsla2, d6wslb2, d6wsle2, d6wslf2
   automated match to d5bmvb1
   complexed with g2p, gtp

Details for d6wslf1

PDB Entry: 6wsl, 3.1 Å

PDB Description: cryo-em structure of vash1-svbp bound to microtubules

PDB Compounds: (F:) Tubulin beta-3 chain

SCOPe Domain Sequences for d6wslf1:

Sequence; same for both SEQRES and ATOM records:

>d6wslf1 c.32.1.1 (F:1-243) automated matches {Homo sapiens [TaxId: 9606]}
mreivhiqagqcgnqigakfwevisdehgidpsgnyvgdsdlqlerisvyyneasshkyv
prailvdlepgtmdsvrsgafghlfrpdnfifgqsgagnnwakghytegaelvdsvldvv
rkecencdclqgfqlthslgggtgsgmgtlliskvreeypdrimntfsvvpspkvsdtvv
epynatlsihqlventdetycidnealydicfrtlklatptygdlnhlvsatmsgvttsl
rfp

Timeline for d6wslf1:

• d6wslf1 is new in SCOPe 2.07-stable
  
• d6wslf1 appears in the current release, SCOPe 2.08