Lineage for d6utjo1 (6utj O:4-223)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700032Superfamily a.24.8: Proteasome activator [47216] (1 family) (S)
  5. 2700033Family a.24.8.1: Proteasome activator [47217] (3 proteins)
  6. 2700046Protein automated matches [190828] (1 species)
    not a true protein
  7. 2700047Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188131] (7 PDB entries)
  8. 2700068Domain d6utjo1: 6utj O:4-223 [392447]
    Other proteins in same PDB: d6utj1_, d6utj2_, d6utja_, d6utjb_, d6utjc_, d6utjd_, d6utje_, d6utjf_, d6utjg_, d6utjh_, d6utji_, d6utjj_, d6utjk_, d6utjl_, d6utjm_, d6utjn_, d6utjo2, d6utjp2, d6utjq2, d6utjr2, d6utjs2, d6utjt2, d6utju2, d6utjv_, d6utjw_, d6utjx_, d6utjy_, d6utjz_
    automated match to d3jrmo_

Details for d6utjo1

PDB Entry: 6utj (more details), 2.9 Å

PDB Description: allosteric couple between alpha rings of the 20s proteasome. 20s proteasome singly capped by pa26/e102a, c-terminus replaced by pan c- terminus
PDB Compounds: (O:) proteasome activator protein PA26

SCOPe Domain Sequences for d6utjo1:

Sequence, based on SEQRES records: (download)

>d6utjo1 a.24.8.1 (O:4-223) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaveahgtirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkvideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
rqidadfmlkvelatthlstmvravinayllnwkkliqpr

Sequence, based on observed residues (ATOM records): (download)

>d6utjo1 a.24.8.1 (O:4-223) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaveahgtirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkvideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
velatthlstmvravinayllnwkkliqpr

SCOPe Domain Coordinates for d6utjo1:

Click to download the PDB-style file with coordinates for d6utjo1.
(The format of our PDB-style files is described here.)

Timeline for d6utjo1: