Lineage for d6utjl_ (6utj L:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2990986Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2993227Species Thermoplasma acidophilum [TaxId:2303] [56253] (7 PDB entries)
  8. 2993234Domain d6utjl_: 6utj L: [392490]
    Other proteins in same PDB: d6utja_, d6utjb_, d6utjc_, d6utjd_, d6utje_, d6utjf_, d6utjg_, d6utjo1, d6utjo2, d6utjp1, d6utjp2, d6utjq1, d6utjq2, d6utjr1, d6utjr2, d6utjs1, d6utjs2, d6utjt1, d6utjt2, d6utju1, d6utju2
    automated match to d3jrmh_

Details for d6utjl_

PDB Entry: 6utj (more details), 2.9 Å

PDB Description: allosteric couple between alpha rings of the 20s proteasome. 20s proteasome singly capped by pa26/e102a, c-terminus replaced by pan c- terminus
PDB Compounds: (L:) Proteasome subunit beta

SCOPe Domain Sequences for d6utjl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6utjl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOPe Domain Coordinates for d6utjl_:

Click to download the PDB-style file with coordinates for d6utjl_.
(The format of our PDB-style files is described here.)

Timeline for d6utjl_: