SCOPe 2.08: Domain d6tvfb_: 6tvf B:

Lineage for d6tvfb_ (6tvf B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (22 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)

8. Domain d6tvfb_: 6tvf B: [392160]
   Other proteins in same PDB: d6tvfa1, d6tvfa2, d6tvfc1, d6tvfc2, d6tvfe1, d6tvfe2, d6tvfg1, d6tvfg2, d6tvfi1, d6tvfi2, d6tvfk_
   automated match to d4d00d_
   complexed with ca, gal, nag, sia

Details for d6tvfb_

PDB Entry: 6tvf, 2.6 Å

PDB Description: crystal structure of the haemagglutinin from a h10n7 seal influenza virus isolated in germany in complex with human receptor analogue, 6'-sln

PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d6tvfb_:

Sequence; same for both SEQRES and ATOM records:

>d6tvfb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnriikktn
tefesiesefseidhqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Timeline for d6tvfb_:

• d6tvfb_ first appeared in SCOPe 2.07