Lineage for d6tvfd_ (6tvf D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041172Domain d6tvfd_: 6tvf D: [392218]
    Other proteins in same PDB: d6tvfa1, d6tvfa2, d6tvfc1, d6tvfc2, d6tvfe1, d6tvfe2, d6tvfg1, d6tvfg2, d6tvfi1, d6tvfi2, d6tvfk_
    automated match to d4d00d_
    complexed with ca, gal, nag, sia

Details for d6tvfd_

PDB Entry: 6tvf (more details), 2.6 Å

PDB Description: crystal structure of the haemagglutinin from a h10n7 seal influenza virus isolated in germany in complex with human receptor analogue, 6'-sln
PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d6tvfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tvfd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnriikktn
tefesiesefseidhqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d6tvfd_:

Click to download the PDB-style file with coordinates for d6tvfd_.
(The format of our PDB-style files is described here.)

Timeline for d6tvfd_: