SCOPe 2.08: Domain d6tvfa1: 6tvf A:1-318

Lineage for d6tvfa1 (6tvf A:1-318)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)

8. Domain d6tvfa1: 6tvf A:1-318 [392091]
   Other proteins in same PDB: d6tvfa2, d6tvfb_, d6tvfc2, d6tvfd_, d6tvfe2, d6tvff_, d6tvfg2, d6tvfh_, d6tvfi2, d6tvfj_, d6tvfl_
   automated match to d3ztna_
   complexed with ca, gal, nag, sia

Details for d6tvfa1

PDB Entry: 6tvf, 2.6 Å

PDB Description: crystal structure of the haemagglutinin from a h10n7 seal influenza virus isolated in germany in complex with human receptor analogue, 6'-sln

PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d6tvfa1:

Sequence; same for both SEQRES and ATOM records:

>d6tvfa1 b.19.1.0 (A:1-318) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dkiclghhavangtivktltneqeevtnatetvestslnrlcmkgrnhkdlgnchpigml
igtpacdlhltgtwdtlierknaiaycypgatvneealrqkimesggiskintgftygss
insagttkacmrnggnsfyaelkwlvsknkgqnfpqttntyrnadtaehlimwgihhpss
tqekndlygtqslsisvgsstyknnfvpvvgarpqvngqsgridfhwtlvqpgdkitfsh
nggliapsrvskligrglgiqseapidnsceskcfwrggsintrlpfqnlsprtvgqcpk
yvnkkslmlatgmrnvpe

Timeline for d6tvfa1:

• d6tvfa1 first appeared in SCOPe 2.07