Lineage for d4d00d_ (4d00 D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041765Species Influenza virus a/jiangxi- donghu/346/2013 (h10n8) [TaxId:11309] [256760] (1 PDB entry)
  8. 3041767Domain d4d00d_: 4d00 D: [257774]
    Other proteins in same PDB: d4d00a_, d4d00c_, d4d00e_
    automated match to d3m5ib_
    complexed with nag, ni

Details for d4d00d_

PDB Entry: 4d00 (more details), 2.5 Å

PDB Description: haemagglutinin of h10n8 influenza virus isolated from humans in complex with human receptor analogue 6'sln
PDB Compounds: (D:) haemagglutinin ha1

SCOPe Domain Sequences for d4d00d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d00d_ h.3.1.1 (D:) automated matches {Influenza virus a/jiangxi- donghu/346/2013 (h10n8) [TaxId: 11309]}
glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninpv

SCOPe Domain Coordinates for d4d00d_:

Click to download the PDB-style file with coordinates for d4d00d_.
(The format of our PDB-style files is described here.)

Timeline for d4d00d_: