SCOPe 2.08: Domain d6ly5f1: 6ly5 f:77-233

Lineage for d6ly5f1 (6ly5 f:77-233)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families)
   automatically mapped to Pfam PF02507

5. Family f.23.16.0: automated matches [276195] (1 protein)
   not a true family

6. Protein automated matches [276199] (5 species)
   not a true protein

7. Species Chaetoceros gracilis [TaxId:184592] [391013] (1 PDB entry)

8. Domain d6ly5f1: 6ly5 f:77-233 [391014]
   Other proteins in same PDB: d6ly5a_, d6ly5b_, d6ly5c_, d6ly5d_, d6ly5e_, d6ly5f2, d6ly5j_
   automated match to d4xk8f_
   complexed with a86, bcr, cla, dd6, dgd, kc1, lhg, lmg, lmt, pqn, sf4, sqd

Details for d6ly5f1

PDB Entry: 6ly5, 2.38 Å

PDB Description: organization and energy transfer in a huge diatom psi-fcpi supercomplex

PDB Compounds: (f:) PsaF

SCOPe Domain Sequences for d6ly5f1:

Sequence; same for both SEQRES and ATOM records:

>d6ly5f1 f.23.16.0 (f:77-233) automated matches {Chaetoceros gracilis [TaxId: 184592]}
disgltpckeskqfakrekqalkklqaslklyaddsapalaikatmektkkrfdnygkyg
llcgsdglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairdekkptqkeii
idvplasrllfrgfswpvaayrellngelvdaaaaaa

Timeline for d6ly5f1:

• d6ly5f1 first appeared in SCOPe 2.07, called d6ly5f_