SCOPe 2.08: Domain d6ly5c_: 6ly5 c:

Lineage for d6ly5c_ (6ly5 c:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
   has C-terminal extension to the common fold

6. Protein automated matches [236563] (10 species)
   not a true protein

7. Species Chaetoceros gracilis [TaxId:184592] [391039] (1 PDB entry)

8. Domain d6ly5c_: 6ly5 c: [391040]
   Other proteins in same PDB: d6ly5a_, d6ly5b_, d6ly5d_, d6ly5e_, d6ly5f1, d6ly5f2, d6ly5j_
   automated match to d5l8rc_
   complexed with a86, bcr, cla, dd6, dgd, kc1, lhg, lmg, lmt, pqn, sf4, sqd

Details for d6ly5c_

PDB Entry: 6ly5, 2.38 Å

PDB Description: organization and energy transfer in a huge diatom psi-fcpi supercomplex

PDB Compounds: (c:) PsaC

SCOPe Domain Sequences for d6ly5c_:

Sequence; same for both SEQRES and ATOM records:

>d6ly5c_ d.58.1.2 (c:) automated matches {Chaetoceros gracilis [TaxId: 184592]}
shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd
flsvrvylwhettrsmglay

Timeline for d6ly5c_:

• d6ly5c_ first appeared in SCOPe 2.07