Lineage for d6la5e1 (6la5 E:5-66)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638750Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2638751Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2638752Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 2638857Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)
  7. 2638858Species Human (Homo sapiens) [TaxId:9606] [90173] (19 PDB entries)
  8. 2638905Domain d6la5e1: 6la5 E:5-66 [390830]
    Other proteins in same PDB: d6la5a_, d6la5c_
    automated match to d1h03p1
    complexed with sph

Details for d6la5e1

PDB Entry: 6la5 (more details), 2.86 Å

PDB Description: cryo-em structure of echovirus 11 complexed with its attaching receptor cd55 at ph 7.4
PDB Compounds: (E:) complement decay-accelerating factor

SCOPe Domain Sequences for d6la5e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6la5e1 g.18.1.1 (E:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
kscpnpgeirngqidvpggilfgatisfscntgyklfgstssfclisgssvqwsdplpec
re

SCOPe Domain Coordinates for d6la5e1:

Click to download the PDB-style file with coordinates for d6la5e1.
(The format of our PDB-style files is described here.)

Timeline for d6la5e1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6la5e2