Lineage for d6la5a_ (6la5 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431063Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2431354Protein automated matches [190854] (25 species)
    not a true protein
  7. 2431392Species Echovirus e11 [TaxId:12078] [390813] (10 PDB entries)
  8. 2431406Domain d6la5a_: 6la5 A: [390844]
    Other proteins in same PDB: d6la5e1, d6la5e2
    automated match to d2x5ia_
    complexed with sph

Details for d6la5a_

PDB Entry: 6la5 (more details), 2.86 Å

PDB Description: cryo-em structure of echovirus 11 complexed with its attaching receptor cd55 at ph 7.4
PDB Compounds: (A:) Capsid protein VP1

SCOPe Domain Sequences for d6la5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6la5a_ b.121.4.1 (A:) automated matches {Echovirus e11 [TaxId: 12078]}
vveavenavarvadtissgpsnsqavpaltavetghtsqvtpsdtiqtrhvrnyhsrses
sienflcrsacvymgeyhttntdtsklfaswtinarrmvqmrrklelftyvrfdmevtfv
itskqdqgtqlgqdmpplthqimyippggpipksvtdytwqtstnpsifwtegnapprms
ipfisignaysnfydgwshfsqngvygyntlnhmgqiyvrhvngssplpmtstvrmyfkp
khvkvwvprpprlcqyknastvnftptnitekrqsinyipetvkp

SCOPe Domain Coordinates for d6la5a_:

Click to download the PDB-style file with coordinates for d6la5a_.
(The format of our PDB-style files is described here.)

Timeline for d6la5a_: