SCOPe 2.07: Domain d6la5e2: 6la5 E:67-129

Lineage for d6la5e2 (6la5 E:67-129)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90173] (19 PDB entries)

8. Domain d6la5e2: 6la5 E:67-129 [390831]
   Other proteins in same PDB: d6la5a_, d6la5c_
   automated match to d1h03p2
   complexed with sph

Details for d6la5e2

PDB Entry: 6la5, 2.86 Å

PDB Description: cryo-em structure of echovirus 11 complexed with its attaching receptor cd55 at ph 7.4

PDB Compounds: (E:) complement decay-accelerating factor

SCOPe Domain Sequences for d6la5e2:

Sequence; same for both SEQRES and ATOM records:

>d6la5e2 g.18.1.1 (E:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
iycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpppe
crg

Timeline for d6la5e2:

• d6la5e2 is new in SCOPe 2.07-stable
  
• d6la5e2 appears in the current release, SCOPe 2.08