Lineage for d7k5zb2 (7k5z B:170-405)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612334Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. 2612335Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. 2612382Family d.210.1.0: automated matches [227194] (1 protein)
    not a true family
  6. 2612383Protein automated matches [226921] (4 species)
    not a true protein
  7. 2612388Species Legionella pneumophila [TaxId:272624] [390414] (2 PDB entries)
  8. 2612390Domain d7k5zb2: 7k5z B:170-405 [390446]
    Other proteins in same PDB: d7k5za1, d7k5zb1, d7k5zc1, d7k5zd1
    automated match to d1vl2a2
    complexed with act, anp, arg, edo, mg

Details for d7k5zb2

PDB Entry: 7k5z (more details), 1.85 Å

PDB Description: crystal structure of argininosuccinate synthase from legionella pneumophila philadelphia 1 in complex with anppnp and a substrate analogue arginine
PDB Compounds: (B:) argininosuccinate synthase

SCOPe Domain Sequences for d7k5zb2:

Sequence, based on SEQRES records: (download)

>d7k5zb2 d.210.1.0 (B:170-405) automated matches {Legionella pneumophila [TaxId: 272624]}
pvtpkapysrdhniwyisheggvledpsqempndvllmtapvsqtpdeeevvvldfkkgv
pvalngqelspvdllnslnqkagqhgigvadivenrlvgmkirgiyeapaaavlykahkl
leslcltrstlhlkqslqqtyanlvyegrwfsqtkqaldafidvtqqhvtgcvklklfkg
niipagmhspyslhhpelatfeednvynqkdaegfinlfslsakiysqvhqggnyd

Sequence, based on observed residues (ATOM records): (download)

>d7k5zb2 d.210.1.0 (B:170-405) automated matches {Legionella pneumophila [TaxId: 272624]}
pvtpkapysrdhniwyisheggvledpsqempndvllmtapvsqtpdeeevvvldfkkgv
pvalngqelspvdllnslnqkagqhgigvadivenrlvgmkirgiyeapaaavlykahkl
leslcltrstlhlkqslqqtyanlvyegrwfsqtkqaldafidvtqqhvtgcvklklfkg
niipagmhspyslhhnqkdaegfinlfslsakiysqvhqggnyd

SCOPe Domain Coordinates for d7k5zb2:

Click to download the PDB-style file with coordinates for d7k5zb2.
(The format of our PDB-style files is described here.)

Timeline for d7k5zb2: