SCOPe 2.07: Domain d7k5zb1: 7k5z B:4-169

Lineage for d7k5zb1 (7k5z B:4-169)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (28 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:272624] [390412] (2 PDB entries)

8. Domain d7k5zb1: 7k5z B:4-169 [390445]
   Other proteins in same PDB: d7k5za2, d7k5zb2, d7k5zc2, d7k5zd2
   automated match to d1vl2a1
   complexed with act, anp, arg, edo, mg

Details for d7k5zb1

PDB Entry: 7k5z, 1.85 Å

PDB Description: crystal structure of argininosuccinate synthase from legionella pneumophila philadelphia 1 in complex with anppnp and a substrate analogue arginine

PDB Compounds: (B:) argininosuccinate synthase

SCOPe Domain Sequences for d7k5zb1:

Sequence; same for both SEQRES and ATOM records:

>d7k5zb1 c.26.2.0 (B:4-169) automated matches {Legionella pneumophila [TaxId: 272624]}
vikkialaysggldtsimipwlkehyehaeviavicdlgqqedldaiknkalksgaskay
vvdvknefatqylwplvksgalyedqyilgtisrpliaqklveialteqvnavahgatgk
gndqvrfeysikalapqleiiapwrtwdiksrqeaivyakahgiev

Timeline for d7k5zb1:

• d7k5zb1 is new in SCOPe 2.07-stable
  
• d7k5zb1 appears in the current release, SCOPe 2.08