Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
Protein automated matches [190116] (28 species) not a true protein |
Species Legionella pneumophila [TaxId:272624] [390412] (2 PDB entries) |
Domain d7k5zc1: 7k5z C:4-169 [390436] Other proteins in same PDB: d7k5za2, d7k5zb2, d7k5zc2, d7k5zd2 automated match to d1vl2a1 complexed with act, anp, arg, edo, mg |
PDB Entry: 7k5z (more details), 1.85 Å
SCOPe Domain Sequences for d7k5zc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k5zc1 c.26.2.0 (C:4-169) automated matches {Legionella pneumophila [TaxId: 272624]} vikkialaysggldtsimipwlkehyehaeviavicdlgqqedldaiknkalksgaskay vvdvknefatqylwplvksgalyedqyilgtisrpliaqklveialteqvnavahgatgk gndqvrfeysikalapqleiiapwrtwdiksrqeaivyakahgiev
Timeline for d7k5zc1: