SCOPe 2.08: Domain d7k5zb2: 7k5z B:170-405

Lineage for d7k5zb2 (7k5z B:170-405)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
   unusual fold

4. Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families)

5. Family d.210.1.0: automated matches [227194] (1 protein)
   not a true family

6. Protein automated matches [226921] (4 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:272624] [390414] (2 PDB entries)

8. Domain d7k5zb2: 7k5z B:170-405 [390446]
   Other proteins in same PDB: d7k5za1, d7k5zb1, d7k5zc1, d7k5zd1
   automated match to d1vl2a2
   complexed with act, anp, arg, edo, mg

Details for d7k5zb2

PDB Entry: 7k5z, 1.85 Å

PDB Description: crystal structure of argininosuccinate synthase from legionella pneumophila philadelphia 1 in complex with anppnp and a substrate analogue arginine

PDB Compounds: (B:) argininosuccinate synthase

SCOPe Domain Sequences for d7k5zb2:

Sequence, based on SEQRES records:

>d7k5zb2 d.210.1.0 (B:170-405) automated matches {Legionella pneumophila [TaxId: 272624]}
pvtpkapysrdhniwyisheggvledpsqempndvllmtapvsqtpdeeevvvldfkkgv
pvalngqelspvdllnslnqkagqhgigvadivenrlvgmkirgiyeapaaavlykahkl
leslcltrstlhlkqslqqtyanlvyegrwfsqtkqaldafidvtqqhvtgcvklklfkg
niipagmhspyslhhpelatfeednvynqkdaegfinlfslsakiysqvhqggnyd

Sequence, based on observed residues (ATOM records):

>d7k5zb2 d.210.1.0 (B:170-405) automated matches {Legionella pneumophila [TaxId: 272624]}
pvtpkapysrdhniwyisheggvledpsqempndvllmtapvsqtpdeeevvvldfkkgv
pvalngqelspvdllnslnqkagqhgigvadivenrlvgmkirgiyeapaaavlykahkl
leslcltrstlhlkqslqqtyanlvyegrwfsqtkqaldafidvtqqhvtgcvklklfkg
niipagmhspyslhhnqkdaegfinlfslsakiysqvhqggnyd

Timeline for d7k5zb2:

• d7k5zb2 first appeared in SCOPe 2.07